Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Septin 3 Rabbit pAb (APR23149N)

Product Specifications

Background

This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Septin 3 Rabbit pAb (APR23149N) .

Synonyms

SEPT3; SEP3; bK250D10.3; septin 3

Gene ID

55964

UniProt

Q9UH03

Cellular Locus

Cell junction, Cytoplasm, cytoskeleton, synapse

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa/40kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55964

Uniprot URL

https://www.uniprot.org/uniprot/Q9UH03

AA Sequence

SPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43963151 3x 1.0 µg DNA

SLC22A6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
PE-conjugated Anti-CD44 antibody (DMC269); IgG1 Chimeric mAb
MBS1882039-01 100 Tests

PE-conjugated Anti-CD44 antibody (DMC269); IgG1 Chimeric mAb

Sign In for Pricing
View Details
PE-conjugated Anti-CD44 antibody (DMC269); IgG1 Chimeric mAb
MBS1882039-02 5x 100 Tests

PE-conjugated Anti-CD44 antibody (DMC269); IgG1 Chimeric mAb

Sign In for Pricing
View Details
32 Antibody
MBS7142125 Inquire

32 Antibody

Sign In for Pricing
View Details
CD59 Antibody
MBS2519138-01 0.06 mL

CD59 Antibody

Sign In for Pricing
View Details
CD59 Antibody
MBS2519138-02 0.12 mL

CD59 Antibody

Sign In for Pricing
View Details