Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHDH Rabbit pAb (APR23142N)

Product Specifications

Background

The protein encoded by this gene is a choline dehydrogenase that localizes to the mitochondrion. Variations in this gene can affect susceptibility to choline deficiency. A few transcript variants have been found for this gene, but the full-length nature of only one has been characterized to date.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHDH Rabbit pAb (APR23136N5) .

Synonyms

CHDH

Gene ID

55349

UniProt

Q8NE62

Cellular Locus

Mitochondrion inner membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55349

Uniprot URL

https://www.uniprot.org/uniprot/Q8NE62

AA Sequence

LHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPK Polyclonal Antibody, Cy5.5 Conjugated
bs-9711R-Cy5.5 100 µL

LIPK Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-HAP1 Antibody Picoband® Fluoro550 Conjugated
A01658-3-Fluoro550 100 µg/Vial

Anti-HAP1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral human TBCA shRNA (UAS) - Lentiviral human TBCA shRNA (UAS) (25)
GTR15319244 1 Vial

Lentiviral human TBCA shRNA (UAS) - Lentiviral human TBCA shRNA (UAS) (25)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS505710 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TMEM53 (Transmembrane protein 53) Expressed in vitro E.coli expression system, Full Length
MPX1555K Each

Magic™ Membrane Protein Human TMEM53 (Transmembrane protein 53) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Mouse Monoclonal ABCA1 Antibody (HJ1) [HRP]
NB100-2068H 0.1 mL

Mouse Monoclonal ABCA1 Antibody (HJ1) [HRP]

Sign In for Pricing
View Details