Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHDH Rabbit pAb (APR23142N)

Product Specifications

Background

The protein encoded by this gene is a choline dehydrogenase that localizes to the mitochondrion. Variations in this gene can affect susceptibility to choline deficiency. A few transcript variants have been found for this gene, but the full-length nature of only one has been characterized to date.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHDH Rabbit pAb (APR23136N5) .

Synonyms

CHDH

Gene ID

55349

UniProt

Q8NE62

Cellular Locus

Mitochondrion inner membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55349

Uniprot URL

https://www.uniprot.org/uniprot/Q8NE62

AA Sequence

LHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Survivin (Surv) Mini Samples ELISA Kit
MBS2087972-01 24 Strip Well

Mouse Survivin (Surv) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Survivin (Surv) Mini Samples ELISA Kit
MBS2087972-02 48 Well

Mouse Survivin (Surv) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Survivin (Surv) Mini Samples ELISA Kit
MBS2087972-03 96 Well

Mouse Survivin (Surv) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Survivin (Surv) Mini Samples ELISA Kit
MBS2087972-04 5x 96 Well

Mouse Survivin (Surv) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Survivin (Surv) Mini Samples ELISA Kit
MBS2087972-05 10x 96 Well

Mouse Survivin (Surv) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Cyclin I (m) -PR
sc-35142-PR 10 µM - 20 µL

Cyclin I (m) -PR

Sign In for Pricing
View Details