Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIN7C Rabbit pAb (APR23141N)

Product Specifications

Background

Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C, CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA receptor subunit NR2B along microtubules (By similarity. This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12 and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LIN7C Rabbit pAb (APR23136N4) .

Synonyms

LIN7C; LIN-7-C; LIN-7C; MALS-3; MALS3; VELI3

Gene ID

55327

UniProt

Q9NUP9

Cellular Locus

Basolateral cell membrane, Cell junction, Cell membrane, Peripheral membrane protein, postsynaptic cell membrane, postsynaptic density, synapse, synaptosome, tight junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55327

Uniprot URL

https://www.uniprot.org/uniprot/Q9NUP9

AA Sequence

MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)
CSB-BP314449HEI-01 20 µg

Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)
CSB-BP314449HEI-02 100 µg

Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)
CSB-BP314449HEI-03 1 mg

Recombinant Hepatitis B virus genotype C subtype ayw Capsid protein (C)

Sign In for Pricing
View Details
NPHP3 Protein Vector (Mouse) (pPB-N-His)
PV206283 500 ng

NPHP3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human OR7G3 shRNA Plasmid
abx968000-01 150 µg

Human OR7G3 shRNA Plasmid

Sign In for Pricing
View Details
Human OR7G3 shRNA Plasmid
abx968000-02 300 µg

Human OR7G3 shRNA Plasmid

Sign In for Pricing
View Details