Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK26 Rabbit pAb (APR23130N)

Product Specifications

Background

The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STK26 Rabbit pAb (APR23125N4) .

Synonyms

STK26; MASK; MST4

Gene ID

51765

UniProt

Q9P289

Cellular Locus

Cytoplasm, Cytoplasmic side, Golgi apparatus membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/39kDa/46kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51765

Uniprot URL

https://www.uniprot.org/uniprot/Q9P289

AA Sequence

EGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KNCN siRNA (Human)
CRJ5600-01 15 nmol

KNCN siRNA (Human)

Sign In for Pricing
View Details
KNCN siRNA (Human)
CRJ5600-02 30 nmol

KNCN siRNA (Human)

Sign In for Pricing
View Details
Recombinant Human IL-36 Gamma (IL-1F9) Protein
PROTQ9NZH8-3 10 µg

Recombinant Human IL-36 Gamma (IL-1F9) Protein

Sign In for Pricing
View Details
GALNT5 Rabbit Polyclonal Antibody (PerCP)
orb2501901 100 µL

GALNT5 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
ZNF266 Polyclonal Conjugated Antibody
orb1625355 100 µL

ZNF266 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
BTRC (Beta Transducin Repeat Containing Protein, F-box and WD-40 Domain Protein 1B, Beta-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, MGC4643, bTrCP, bTrCP1, betaTrCP) (HRP)
MBS6408966-01 0.1 mL

BTRC (Beta Transducin Repeat Containing Protein, F-box and WD-40 Domain Protein 1B, Beta-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, MGC4643, bTrCP, bTrCP1, betaTrCP) (HRP)

Sign In for Pricing
View Details