Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMN2 Rabbit pAb (APR23114N)

Product Specifications

Background

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. While mutations in the telomeric copy are associated with spinal muscular atrophy, mutations in this gene, the centromeric copy, do not lead to disease. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The full length protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs) . This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Four transcript variants encoding distinct isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SMN2 Rabbit pAb (APR23114N) .

Synonyms

SMN2; BCD541; C-BCD541; GEMIN1; SMNC; TDRD16B

Gene ID

6607

UniProt

Q16637

Cellular Locus

Cajal body, Cytoplasm, Cytoplasmic granule, Nucleus, Z line, gem, myofibril, sarcomere

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/28kDa/30kDa/31kDa Observed MW: 32kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6607

Uniprot URL

https://www.uniprot.org/uniprot/Q16637

AA Sequence

MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human TGDS sgRNA gene knockout kit - Lentiviral human TGDS sgRNA gene knockout kit (plasmid)
GTR15389687 1 Vial

Lentiviral human TGDS sgRNA gene knockout kit - Lentiviral human TGDS sgRNA gene knockout kit (plasmid)

Ask
View Details
Mouse Monoclonal HIV-1 p24 Antibody (HIV1-24/661) [HRP]
NBP2-34636H 0.1 mL

Mouse Monoclonal HIV-1 p24 Antibody (HIV1-24/661) [HRP]

Ask
View Details
Rabbit anti-Escherichia coli O81 (strain ED1a) deoA Polyclonal Antibody
MBS7142577 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) deoA Polyclonal Antibody

Ask
View Details
Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (AP)
MBS6455788-01 0.2 mL

Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (AP)

Ask
View Details
Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (AP)
MBS6455788-02 5x 0.2 mL

Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (AP)

Ask
View Details