Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY10 Rabbit pAb (APR23111N)

Product Specifications

Background

The protein encoded by this gene belongs to the family of G-protein coupled receptors that are preferentially activated by adenosine and uridine nucleotides. There is a pseudogene for this gene nearby on chromosome X. Multiple alternatively spliced transcripts have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P2RY10 Rabbit pAb (APR23103N7) .

Synonyms

P2RY10; LYPSR2; P2Y10

Gene ID

27334

UniProt

O00398

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27334

Uniprot URL

https://www.uniprot.org/uniprot/O00398

AA Sequence

TVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rexo1 Mouse Gene Knockout Kit (CRISPR)
KN514685 1 Kit

Rexo1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GDF15 (Growth Differentiation Factor 15) CLIA Kit
E-CL-H0080-01 24 Tests

Human GDF15 (Growth Differentiation Factor 15) CLIA Kit

Sign In for Pricing
View Details
Human GDF15 (Growth Differentiation Factor 15) CLIA Kit
E-CL-H0080-02 48 Tests

Human GDF15 (Growth Differentiation Factor 15) CLIA Kit

Sign In for Pricing
View Details
Human GDF15 (Growth Differentiation Factor 15) CLIA Kit
E-CL-H0080-03 96 Tests

Human GDF15 (Growth Differentiation Factor 15) CLIA Kit

Sign In for Pricing
View Details
ZNF733P Human qPCR Primer Pair (NR_003952)
HP220631 200 Reactions

ZNF733P Human qPCR Primer Pair (NR_003952)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS711809 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details