Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY10 Rabbit pAb (APR23111N)

Product Specifications

Background

The protein encoded by this gene belongs to the family of G-protein coupled receptors that are preferentially activated by adenosine and uridine nucleotides. There is a pseudogene for this gene nearby on chromosome X. Multiple alternatively spliced transcripts have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P2RY10 Rabbit pAb (APR23103N7) .

Synonyms

P2RY10; LYPSR2; P2Y10

Gene ID

27334

UniProt

O00398

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27334

Uniprot URL

https://www.uniprot.org/uniprot/O00398

AA Sequence

TVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS703278 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right upper lobe
CS502770 5x 5 µm

Frozen Tissue Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Eif1ad (NM_027236) Mouse Tagged ORF Clone
MG201426 10 µg

Eif1ad (NM_027236) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1+S2 trimer Protein (C-His Tag) (Omicron)
PKSV030478 50 µg

Recombinant SARS-CoV-2 S1+S2 trimer Protein (C-His Tag) (Omicron)

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), 0.2mg/mL
BNUB2340-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), 0.2mg/mL

Sign In for Pricing
View Details
NDRG1 Recombinant Rabbit Monoclonal Antibody [JM32-02]
ET1705-20 100 µL

NDRG1 Recombinant Rabbit Monoclonal Antibody [JM32-02]

Sign In for Pricing
View Details