Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPTC Rabbit pAb (APR23108N)

Product Specifications

Background

Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also localizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OPTC Rabbit pAb (APR23103N4) .

Synonyms

OPTC; OPT; opticin

Gene ID

26254

UniProt

Q9UBM4

Cellular Locus

Secreted, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26254

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBM4

AA Sequence

ASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2 alpha Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62206R-APC-Cy5.5 100 µL

AP2 alpha Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Il10rb (NM_001107111) Rat Tagged ORF Clone Lentiviral Particle
RR204577L4V 200 µL

Il10rb (NM_001107111) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pcyt2 AAV siRNA Pooled Vector
36249166 1.0 µg

Pcyt2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human MMP3/Stromelysin-1 ELISA Kit
E45K00152 96 Tests

Human MMP3/Stromelysin-1 ELISA Kit

Sign In for Pricing
View Details
West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) (Biotin) discontinued
W1018-52C-Biotin 100 µL

West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, Envelope Protein M, Matrix Protein, West Nile Virus Envelope Protein M) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant human CRABP2 protein
RBP0801-100 100 µg

Recombinant human CRABP2 protein

Sign In for Pricing
View Details