OPTC Rabbit pAb (APR23108N)
Product Specifications
Background
Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also localizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1) .
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OPTC Rabbit pAb (APR23103N4) .
Synonyms
OPTC; OPT; opticin
Gene ID
26254
UniProt
Q9UBM4
Cellular Locus
Secreted, extracellular matrix, extracellular space
Dilution
WB 1:500 - 1:2000
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 37kDa Observed MW: 54kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26254
Uniprot URL
https://www.uniprot.org/uniprot/Q9UBM4
AA Sequence
ASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10320881 96 Well
Porcine CDP diacylglycerol glycerol 3 phosphate 3 phosphatidyltransferase, mitochondrial (PGS1) ELISA Kit
Sign In for Pricing
View Details 
MBS2080384-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
Sign In for Pricing
View Details MBS2080384-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
Sign In for Pricing
View Details MBS2080384-03 0.5 mL
Cy3-Linked Polyclonal Antibody to Immunoglobulin Superfamily Containing Leucine Rich Repeat Protein (ISLR)
Sign In for Pricing
View Details