Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPTC Rabbit pAb (APR23108N)

Product Specifications

Background

Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also localizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OPTC Rabbit pAb (APR23103N4) .

Synonyms

OPTC; OPT; opticin

Gene ID

26254

UniProt

Q9UBM4

Cellular Locus

Secreted, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26254

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBM4

AA Sequence

ASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase delta, catalytic subunit Rabbit Polyclonal Antibody (PerCP)
orb2551177 100 µL

DNA Polymerase delta, catalytic subunit Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
RFC2 Conjugated Antibody
C43122 100 µL

RFC2 Conjugated Antibody

Sign In for Pricing
View Details
GDF-6 Rabbit pAb
E2251718 100 µL

GDF-6 Rabbit pAb

Sign In for Pricing
View Details
SLURP1 Human qPCR Template Standard (NM_020427)
HK210812 1 Kit

SLURP1 Human qPCR Template Standard (NM_020427)

Sign In for Pricing
View Details
A1BG Rabbit pAb
A8969 100 µL

A1BG Rabbit pAb

Sign In for Pricing
View Details
Nphs1-set siRNA/shRNA/RNAi Lentivector (Mouse)
32060094 4x 500 ng

Nphs1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details