Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR4 Rabbit pAb (APR23079N)

Product Specifications

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WDR4 Rabbit pAb (APR23072N7) .

Synonyms

WDR4; TRM82; TRMT82

Gene ID

10785

UniProt

P57081

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10785

Uniprot URL

https://www.uniprot.org/uniprot/P57081

AA Sequence

SRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR4 (NM_213647) Human Over-expression Lysate
LY431021 100 µg

FGFR4 (NM_213647) Human Over-expression Lysate

Sign In for Pricing
View Details
Solabegron Hydrochloride
TRC-S676510-1MG 1 mg

Solabegron Hydrochloride

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Human IgG
TAF-001-2 2 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Human IgG

Sign In for Pricing
View Details
EMA (MUC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A5]
TA800939BM 100 µL

EMA (MUC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3080), CF405S conjugate, 0.1mg/mL
BNC043080-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3080), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse ICAM1 Recombinant Rabbit monoclonal Antibody
HA723833 100 µL

Mouse ICAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details