Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD4 Rabbit pAb (APR23060N)

Product Specifications

Background

This gene encodes a member of the apyrase protein family. Apyrases are enzymes that catalyze the hydrolysis of nucleotide diphosphates and triphosphates in a calcium or magnesium-dependent manner. The encoded protein is an endo-apyrase and may play a role in salvaging nucleotides from lysosomes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and these isoforms may differ in divalent cation dependence and substrate specificity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ENTPD4 Rabbit pAb (APR23060N) .

Synonyms

ENTPD4; LALP70; LAP70; LYSAL1; NTPDase-4; UDPase

Gene ID

9583

UniProt

Q9Y227

Cellular Locus

Cytoplasmic vesicle, Golgi apparatus membrane, Multi-pass membrane protein, autophagosome membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa/70kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9583

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y227

AA Sequence

LTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CPSF2 (NM_017437) Human Tagged ORF Clone
RG209857 10 µg

CPSF2 (NM_017437) Human Tagged ORF Clone

Ask
View Details
CACNA1E (Voltage-Dependent R-Type Calcium Channel Subunit alpha-1E, Brain Calcium Channel II, BII, Calcium Channel, L Type, alpha-1 Polypeptide, Isoform 6, Voltage-Gated Calcium Channel Subunit alpha Cav2.3, CACNA1E, CACH6, CACNL1A6) discontinued
221246-01 50 µL

CACNA1E (Voltage-Dependent R-Type Calcium Channel Subunit alpha-1E, Brain Calcium Channel II, BII, Calcium Channel, L Type, alpha-1 Polypeptide, Isoform 6, Voltage-Gated Calcium Channel Subunit alpha Cav2.3, CACNA1E, CACH6, CACNL1A6) discontinued

Ask
View Details
CACNA1E (Voltage-Dependent R-Type Calcium Channel Subunit alpha-1E, Brain Calcium Channel II, BII, Calcium Channel, L Type, alpha-1 Polypeptide, Isoform 6, Voltage-Gated Calcium Channel Subunit alpha Cav2.3, CACNA1E, CACH6, CACNL1A6) discontinued
221246-02 100 µL

CACNA1E (Voltage-Dependent R-Type Calcium Channel Subunit alpha-1E, Brain Calcium Channel II, BII, Calcium Channel, L Type, alpha-1 Polypeptide, Isoform 6, Voltage-Gated Calcium Channel Subunit alpha Cav2.3, CACNA1E, CACH6, CACNL1A6) discontinued

Ask
View Details
Lentiviral human PRRC2C shRNA (UAS) - Lentiviral human PRRC2C shRNA (UAS, RFP) plasmid
GTR15350464 1 Vial

Lentiviral human PRRC2C shRNA (UAS) - Lentiviral human PRRC2C shRNA (UAS, RFP) plasmid

Ask
View Details
Canine Anti-Islet Cell Anti-bodies (ICA) ELISA Kit
NSL1916Ca 96 Tests

Canine Anti-Islet Cell Anti-bodies (ICA) ELISA Kit

Ask
View Details
TMEM40 (Biotin)
579389-01 50 µg

TMEM40 (Biotin)

Ask
View Details