Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAMKL1/DCLK1 Rabbit pAb (APR23055N)

Product Specifications

Background

This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCAMKL1/DCLK1 Rabbit pAb (APR23055N) .

Synonyms

DCLK1; CL1; CLICK1; DCAMKL1; DCDC3A; DCLK

Gene ID

9201

UniProt

O15075

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/47kDa/81kDa/82kDa Observed MW: 82kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9201

Uniprot URL

https://www.uniprot.org/uniprot/O15075

AA Sequence

VDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMHR2 Antibody
R34253-100UG 100 µg

AMHR2 Antibody

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial
orb3155689-01 20 µg

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial
orb3155689-02 100 µg

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial
orb3155689-03 1 mg

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial

Sign In for Pricing
View Details
SMARCA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV629794 1.0 µg DNA

SMARCA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ANKFN1 siRNA (h)
sc-94060 10 µM

ANKFN1 siRNA (h)

Sign In for Pricing
View Details