Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1A1 Rabbit pAb (APR23044N)

Product Specifications

Background

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OR1A1 Rabbit pAb (APR23044N) .

Synonyms

OR1A1; OR17-7

Gene ID

8383

UniProt

Q9P1Q5

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8383

Uniprot URL

https://www.uniprot.org/uniprot/Q9P1Q5

AA Sequence

MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAP Kinase 2 (Mitogen-activated Protein Kinase 2, MAPK 2, MAPK2, Extracellular Signal-regulated Kinase 2, ERK2, ERK-2, ERK, ERT1, MAP Kinase Isoform p42, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk1, Mapk, p42mapk, p42-MAPK, Prkm1, PRKM2) (MaxLight 405) discontinued
M2362-05-ML405 100 µL

MAP Kinase 2 (Mitogen-activated Protein Kinase 2, MAPK 2, MAPK2, Extracellular Signal-regulated Kinase 2, ERK2, ERK-2, ERK, ERT1, MAP Kinase Isoform p42, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk1, Mapk, p42mapk, p42-MAPK, Prkm1, PRKM2) (MaxLight 405) discontinued

Ask
View Details
TipOne 100 uL Profile Point Filter Tip Refill case pack, sterile, 80 cassettes of 96 tips (total 7680 tips)
1123-1760 7680 Tips

TipOne 100 uL Profile Point Filter Tip Refill case pack, sterile, 80 cassettes of 96 tips (total 7680 tips)

Ask
View Details
Lentiviral human CRYBB2 shRNA (UAS) - Lentiviral human CRYBB2 shRNA (UAS, GFP) (25)
GTR15149300 1 Vial

Lentiviral human CRYBB2 shRNA (UAS) - Lentiviral human CRYBB2 shRNA (UAS, GFP) (25)

Ask
View Details
PARP11 Antibody
GWB-38FD4A 0.1 mg

PARP11 Antibody

Ask
View Details
Rabbit Polyclonal OPA1 Antibody [DyLight 594]
NB110-55290DL594 0.1 mL

Rabbit Polyclonal OPA1 Antibody [DyLight 594]

Ask
View Details
HAUS3, ID (HAUS3, C4orf15, HAUS augmin-like complex subunit 3) (Biotin)
MBS6305484-01 0.2 mL

HAUS3, ID (HAUS3, C4orf15, HAUS augmin-like complex subunit 3) (Biotin)

Ask
View Details