Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1/CD274 Rabbit pAb (APR23040N)

Product Specifications

Background

This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PD-L1/CD274 Rabbit pAb (APR23040N) .

Synonyms

B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1; CD274

Gene ID

29126

UniProt

Q9NZQ7

Cellular Locus

Cell membrane, Endomembrane system, Single-pass type I membrane protein

Applications

IHC (Human gastric cancer tissue, Human gastric mucosa, Human liver cancer, Homo sapiens) WB (Homo sapiens, Mus musculus) IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa/33kDa Observed MW: 40-50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29126

Uniprot URL

https://www.uniprot.org/uniprot/Q9NZQ7

AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)
MBS1053380-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)

Ask
View Details
Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)
MBS1053380-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)

Ask
View Details
Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)
MBS1053380-03 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)

Ask
View Details
Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)
MBS1053380-04 0.1 mg (Yeast)

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)

Ask
View Details
Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)
MBS1053380-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)

Ask
View Details
Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)
MBS1053380-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O157:H7 Thiol:disulfide interchange protein DsbG (dsbG)

Ask
View Details