Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP4 Rabbit pAb (APR23021N)

Product Specifications

Background

The protein encoded by this gene is a transcription factor that can bind to the GC promoter region of a variety of genes, including those of the photoreceptor signal transduction system. The encoded protein binds to the same sites in promoter CpG islands as does the transcription factor SP1, although its expression is much more restricted compared to that of SP1. This gene may be involved in bipolar disorder and schizophrenia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SP4 Rabbit pAb (APR23019N1) .

Synonyms

SP4; HF1B; SPR-1

Gene ID

6671

UniProt

Q02446

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 81kDa Observed MW: 82kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6671

Uniprot URL

https://www.uniprot.org/uniprot/Q02446

AA Sequence

TGQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQYASTSASSSERTIEESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptopodin (SYNPO) Human shRNA Plasmid Kit (Locus ID 11346)
TG308982 1 Kit

Synaptopodin (SYNPO) Human shRNA Plasmid Kit (Locus ID 11346)

Sign In for Pricing
View Details
Goat Copine 2 (CPNE2) ELISA kit
GTR10439841 96 Well

Goat Copine 2 (CPNE2) ELISA kit

Sign In for Pricing
View Details
Fibcd1 (NM_178887) Mouse Tagged ORF Clone Lentiviral Particle
MR203580L3V 200 µL

Fibcd1 (NM_178887) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Secreted phosphoprotein 24 (SPP2) ELISA Kit
GTR10342395 96 Well

Mouse Secreted phosphoprotein 24 (SPP2) ELISA Kit

Sign In for Pricing
View Details
3/4 wide x 500 White Tape
TAP1096 1 Each

3/4 wide x 500 White Tape

Sign In for Pricing
View Details
Camel Caspase 2 ELISA Kit
MBS066890-01 48 Well

Camel Caspase 2 ELISA Kit

Sign In for Pricing
View Details