Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PI4KB Rabbit pAb (APR23005N)

Product Specifications

Background

Phosphorylates phosphatidylinositol (PI in the first committed step in the production of the second messenger inositol-1,4,5, -trisphosphate (PIP. May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PI4KB Rabbit pAb (APR23000N6) .

Synonyms

PI4KB; NPIK; PI4K-BETA; PI4K92; PI4KBETA; PI4KIIIBETA; PIK4CB

Gene ID

5298

UniProt

Q9UBF8

Cellular Locus

Cytoplasm, Endomembrane system, Golgi apparatus, Mitochondrion outer membrane, Peripheral membrane protein, Rough endoplasmic reticulum membrane, perinuclear region

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 54kDa/89kDa/91kDa Observed MW: 91kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5298

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBF8

AA Sequence

AFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CellExp™ DLK1, Human Recombinant
P1166-10 10 µg

Human CellExp™ DLK1, Human Recombinant

Sign In for Pricing
View Details
Goat Peroxisome Assembly Factor 2 (PEX6) ELISA Kit
MBS9932412 Inquire

Goat Peroxisome Assembly Factor 2 (PEX6) ELISA Kit

Sign In for Pricing
View Details
Calpastatin Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-6701R-PerCP-Cy5.5 100 µL

Calpastatin Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
MST1/2 (Serine/threonine-Protein Kinase 4, Mammalian STE20-like Protein Kinase 1, MST-1, STE20-like Kinase MST1, Serine/threonine-Protein Kinase Krs-2, MST1/C STK4, KRS2, MST1, Serine/threonine-Protein Kinase 3, Mammalian STE20-like Protein Kinase 2, MST-2, STE20-like Kinase MST2, Serine/threonine-Protein Kinase Krs-1, MST2/C, STK3, KRS1, MST2) discontinued
224309-01 50 µL

MST1/2 (Serine/threonine-Protein Kinase 4, Mammalian STE20-like Protein Kinase 1, MST-1, STE20-like Kinase MST1, Serine/threonine-Protein Kinase Krs-2, MST1/C STK4, KRS2, MST1, Serine/threonine-Protein Kinase 3, Mammalian STE20-like Protein Kinase 2, MST-2, STE20-like Kinase MST2, Serine/threonine-Protein Kinase Krs-1, MST2/C, STK3, KRS1, MST2) discontinued

Sign In for Pricing
View Details
MST1/2 (Serine/threonine-Protein Kinase 4, Mammalian STE20-like Protein Kinase 1, MST-1, STE20-like Kinase MST1, Serine/threonine-Protein Kinase Krs-2, MST1/C STK4, KRS2, MST1, Serine/threonine-Protein Kinase 3, Mammalian STE20-like Protein Kinase 2, MST-2, STE20-like Kinase MST2, Serine/threonine-Protein Kinase Krs-1, MST2/C, STK3, KRS1, MST2) discontinued
224309-02 100 µL

MST1/2 (Serine/threonine-Protein Kinase 4, Mammalian STE20-like Protein Kinase 1, MST-1, STE20-like Kinase MST1, Serine/threonine-Protein Kinase Krs-2, MST1/C STK4, KRS2, MST1, Serine/threonine-Protein Kinase 3, Mammalian STE20-like Protein Kinase 2, MST-2, STE20-like Kinase MST2, Serine/threonine-Protein Kinase Krs-1, MST2/C, STK3, KRS1, MST2) discontinued

Sign In for Pricing
View Details
Lnpep (NM_001113403) Rat Untagged Clone
RN200189 10 µg

Lnpep (NM_001113403) Rat Untagged Clone

Sign In for Pricing
View Details