Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytokeratin 13 (KRT13) Rabbit pAb (APR22982N)

Product Specifications

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cytokeratin 13 (KRT13) Rabbit pAb (APR22982N) .

Synonyms

KRT13; CK13; K13; WSN2

Gene ID

3860

UniProt

P13646

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa/45kDa/49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3860

Uniprot URL

https://www.uniprot.org/uniprot/P13646

AA Sequence

DLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Plexin domain-containing protein 2 (PLXDC2), partial
RPC29747-01 20 µg

Recombinant Human Plexin domain-containing protein 2 (PLXDC2), partial

Sign In for Pricing
View Details
Recombinant Human Plexin domain-containing protein 2 (PLXDC2), partial
RPC29747-02 100 µg

Recombinant Human Plexin domain-containing protein 2 (PLXDC2), partial

Sign In for Pricing
View Details
Recombinant Human Plexin domain-containing protein 2 (PLXDC2), partial
RPC29747-03 1 mg

Recombinant Human Plexin domain-containing protein 2 (PLXDC2), partial

Sign In for Pricing
View Details
Hot Plate
2051680/1U 1 Each

Hot Plate

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hedgehog Homolog, Desert (DHH)
MBS2070128-01 0.1 mL

APC-Linked Polyclonal Antibody to Hedgehog Homolog, Desert (DHH)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hedgehog Homolog, Desert (DHH)
MBS2070128-02 0.2 mL

APC-Linked Polyclonal Antibody to Hedgehog Homolog, Desert (DHH)

Sign In for Pricing
View Details