Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCR1 Rabbit pAb (APR22974N)

Product Specifications

Background

The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8) . It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CXCR1 Rabbit pAb (APR22974N) .

Synonyms

CXCR1; C-C; C-C-CKR-1; CD128; CD181; CDw128a; CKR-1; CMKAR1; IL8R1; IL8RA; IL8RBA

Gene ID

3577

UniProt

P25024

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3577

Uniprot URL

https://www.uniprot.org/uniprot/P25024

AA Sequence

IFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCLNPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-conjugated Anti-IL1A (bermekimab biosimilar) mAb
MBS1880571-01 100 Tests

PE-conjugated Anti-IL1A (bermekimab biosimilar) mAb

Sign In for Pricing
View Details
PE-conjugated Anti-IL1A (bermekimab biosimilar) mAb
MBS1880571-02 5x 100 Tests

PE-conjugated Anti-IL1A (bermekimab biosimilar) mAb

Sign In for Pricing
View Details
Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit
MBS1600305-01 48 Well

Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit

Sign In for Pricing
View Details
Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit
MBS1600305-02 96 Well

Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit

Sign In for Pricing
View Details
Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit
MBS1600305-03 5x 96 Well

Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit

Sign In for Pricing
View Details
Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit
MBS1600305-04 10x 96 Well

Rat Oxoguanine Glycosylase 1 (OGG1) ELISA Kit

Sign In for Pricing
View Details