Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGD1 Rabbit pAb (APR22961N)

Product Specifications

Background

This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of faciogenital dysplasia and X-linked mental retardation, syndromatic 16.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGD1 Rabbit pAb (APR22961N) .

Synonyms

FGD1; AAS; FGDY; MRXS16; ZFYVE3; FYVE

Gene ID

2245

UniProt

P98174

Cellular Locus

Cell projection, Cytoplasm, cytoskeleton, lamellipodium, ruffle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 106kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2245

Uniprot URL

https://www.uniprot.org/uniprot/P98174

AA Sequence

LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF
MBS6393198-01 0.1 mL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF

Sign In for Pricing
View Details
S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF
MBS6393198-02 5x 0.1 mL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF

Sign In for Pricing
View Details
CDC42   monoclonal antibody
MB10710 50ul

CDC42 monoclonal antibody

Sign In for Pricing
View Details
TRSPAP1 (TRNAU1AP) (NM_017846) Human Untagged Clone
SC321354 10 µg

TRSPAP1 (TRNAU1AP) (NM_017846) Human Untagged Clone

Sign In for Pricing
View Details
Cell cycle reporter lentivirus (G1, orange) - Cell cycle reporter lentivirus (G1, orange)
GTR15424488 25 µL (1x 25 µL)

Cell cycle reporter lentivirus (G1, orange) - Cell cycle reporter lentivirus (G1, orange)

Sign In for Pricing
View Details
JNJ-10181457
574759 1.0mg

JNJ-10181457

Sign In for Pricing
View Details