Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGD1 Rabbit pAb (APR22961N)

Product Specifications

Background

This gene encodes a protein that contains Dbl (DH) and pleckstrin (PH) homology domains and is similar to the Rho family of small GTP-binding proteins. The encoded protein specifically binds to the Rho family GTPase Cdc42Hs and can stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. Defects in this gene are the cause of faciogenital dysplasia and X-linked mental retardation, syndromatic 16.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGD1 Rabbit pAb (APR22961N) .

Synonyms

FGD1; AAS; FGDY; MRXS16; ZFYVE3; FYVE

Gene ID

2245

UniProt

P98174

Cellular Locus

Cell projection, Cytoplasm, cytoskeleton, lamellipodium, ruffle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 106kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2245

Uniprot URL

https://www.uniprot.org/uniprot/P98174

AA Sequence

LLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVPGSSPACS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUN, Phosphorylated (T239) (Activator Protein 1, AP1, AP-1, c-Jun) (PE)
MBS6423525-01 0.1 mL

JUN, Phosphorylated (T239) (Activator Protein 1, AP1, AP-1, c-Jun) (PE)

Sign In for Pricing
View Details
JUN, Phosphorylated (T239) (Activator Protein 1, AP1, AP-1, c-Jun) (PE)
MBS6423525-02 5x 0.1 mL

JUN, Phosphorylated (T239) (Activator Protein 1, AP1, AP-1, c-Jun) (PE)

Sign In for Pricing
View Details
Cd3g Mouse Pre-designed siRNA Set A
HY-RS17366 1 Set

Cd3g Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K (VCA) beta-4, Maxi K Channel Subunit beta-4, Slo-beta-4) (FITC)
128755-FITC 100 µL

KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K (VCA) beta-4, Maxi K Channel Subunit beta-4, Slo-beta-4) (FITC)

Sign In for Pricing
View Details
Canine Erythropoietin,EPO ELISA KIT
JOT-EK0209Ca 96 wells

Canine Erythropoietin,EPO ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal CARHSP1 Antibody [mFluor Violet 610 SE]
NBP2-99494MFV610 0.1 mL

Rabbit Polyclonal CARHSP1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details