Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EREG Rabbit pAb (APR22959N)

Product Specifications

Background

This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4 (ERBB4) . The encoded protein may be involved in a wide range of biological processes including inflammation, wound healing, oocyte maturation, and cell proliferation. Additionally, the encoded protein may promote the progression of cancers of various human tissues.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EREG Rabbit pAb (APR22956N2) .

Synonyms

EREG; EPR; ER; Ep

Gene ID

2069

UniProt

O14944

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa Observed MW: 17KDa/19KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2069

Uniprot URL

https://www.uniprot.org/uniprot/O14944

AA Sequence

GVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (APC)
MBS6124840-01 0.1 mL

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (APC)

Sign In for Pricing
View Details
CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (APC)
MBS6124840-02 5x 0.1 mL

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (APC)

Sign In for Pricing
View Details
FAM43A Protein Lysate (Human) with C-Ha Tag
20027031 100 µg

FAM43A Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MRPS6 Antibody
CSB-PA014937ESR1HU-01 50 μL

MRPS6 Antibody

Sign In for Pricing
View Details
MRPS6 Antibody
CSB-PA014937ESR1HU-02 100 µL

MRPS6 Antibody

Sign In for Pricing
View Details
RNA Extraction, Whole Blood, BioAssayTM Kit
299031 50 Tests

RNA Extraction, Whole Blood, BioAssayTM Kit

Sign In for Pricing
View Details