Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A3 Rabbit pAb (APR22944N)

Product Specifications

Background

Type IV collagen, the major structural component of basement membranes, is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. This gene encodes alpha 3. In the Goodpasture syndrome, autoantibodies bind to the collagen molecules in the basement membranes of alveoli and glomeruli. The epitopes that elicit these autoantibodies are localized largely to the non-collagenous C-terminal domain of the protein. A specific kinase phosphorylates amino acids in this same C-terminal region and the expression of this kinase is upregulated during pathogenesis. This gene is also linked to an autosomal recessive form of Alport syndrome. The mutations contributing to this syndrome are also located within the exons that encode this C-terminal region. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COL4A3 Rabbit pAb (APR22934N9) .

Synonyms

COL4A3

Gene ID

1285

UniProt

Q01955

Cellular Locus

Secreted, basement membrane, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 135kDa/142kDa/158kDa/161kDa Observed MW: 162kDa/26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1285

Uniprot URL

https://www.uniprot.org/uniprot/Q01955

AA Sequence

SPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCP1 (CTDP1) Human qPCR Template Standard (NM_048368)
HK211495 1 Kit

FCP1 (CTDP1) Human qPCR Template Standard (NM_048368)

Sign In for Pricing
View Details
Leucine-rich repeat-containing protein 16C (RLTPR) Human ELISA Kit
E6504 96 Tests

Leucine-rich repeat-containing protein 16C (RLTPR) Human ELISA Kit

Sign In for Pricing
View Details
Inotuzumab Biosimilar - Research Grade
ICH5247-1mg 1 mg

Inotuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
HADHB Antibody, Biotin conjugated
A39634-50UG 50 µg

HADHB Antibody, Biotin conjugated

Sign In for Pricing
View Details
P15RS (C-6) FITC
sc-514724 FITC 200 µg/mL

P15RS (C-6) FITC

Sign In for Pricing
View Details
HADHSC (HADH) Mouse Monoclonal Antibody [Clone ID: LBI3F11]
AMM15755V 100 µL

HADHSC (HADH) Mouse Monoclonal Antibody [Clone ID: LBI3F11]

Sign In for Pricing
View Details