Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] FSP1/S100A4 Rabbit pAb (APR22895N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] FSP1/S100A4 Rabbit pAb (APR22895N) .

Synonyms

18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98; S100A4

Gene ID

6275

UniProt

P26447

Applications

WB (mouse cells, Mus musculus, Homo sapiens) IF (Rattus norvegicus, Homo sapiens) IHC (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 12KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6275

Uniprot URL

https://www.uniprot.org/uniprot/P26447

AA Sequence

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX28P2 ORF Vector (Human) (pORF)
46546011 1.0 µg DNA

TEX28P2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human Helicobacter pylori IgM (Hp-IgM) ELISA Kit
GA-E1380HM-01 48 Tests

Human Helicobacter pylori IgM (Hp-IgM) ELISA Kit

Sign In for Pricing
View Details
Human Helicobacter pylori IgM (Hp-IgM) ELISA Kit
GA-E1380HM-02 96 Tests

Human Helicobacter pylori IgM (Hp-IgM) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) HACD3 Polyclonal Antibody
MBS7198501 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) HACD3 Polyclonal Antibody

Sign In for Pricing
View Details
Camel Zinc Finger Protein Basonuclin-1 (BNC1) ELISA Kit
MBS9906622-01 48 Well

Camel Zinc Finger Protein Basonuclin-1 (BNC1) ELISA Kit

Sign In for Pricing
View Details
Camel Zinc Finger Protein Basonuclin-1 (BNC1) ELISA Kit
MBS9906622-02 96 Well

Camel Zinc Finger Protein Basonuclin-1 (BNC1) ELISA Kit

Sign In for Pricing
View Details