[KO Validated] FSP1/S100A4 Rabbit pAb (APR22895N)
Product Specifications
Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] FSP1/S100A4 Rabbit pAb (APR22895N) .
Synonyms
18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98; S100A4
Gene ID
6275
UniProt
P26447
Applications
WB (mouse cells, Mus musculus, Homo sapiens) IF (Rattus norvegicus, Homo sapiens) IHC (Homo sapiens, Mus musculus)
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 11kDa Observed MW: 12KDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6275
Uniprot URL
https://www.uniprot.org/uniprot/P26447
AA Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6248081-01 0.1 mL
Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin Kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (AP)
Sign In for Pricing
View Details 
MBS6248081-02 5x 0.1 mL
Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin Kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (AP)
Sign In for Pricing
View Details 123269-Biotin 100 µL
ALS2CR2 (STE20-related Kinase Adapter Protein beta, STRAD beta, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein, CALS-21, ILP-interacting Protein, Pseudokinase ALS2CR2, STRADB, ILPIP, PRO1038) (Biotin)
Sign In for Pricing
View Details TL302942V 500 µL Each
Neuroligin 4 (NLGN4X) Human shRNA Lentiviral Particle (Locus ID 57502)
Sign In for Pricing
View Details MBS2062095-01 0.1 mL
APC/CY7-Linked Polyclonal Antibody to 17-Alpha-Hydroxylase (S17aH)
Sign In for Pricing
View Details