Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRA1 Rabbit pAb (APR22881N)

Product Specifications

Background

Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SRA1 Rabbit pAb (APR22881N) .

Synonyms

SRA1; SRA; SRAP; STRAA1; pp7684

Gene ID

10011

UniProt

Q9HD15

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 26kDa, 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10011

Uniprot URL

https://www.uniprot.org/uniprot/Q9HD15

AA Sequence

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)
MBS2138263-01 0.1 mL

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)

Ask
View Details
FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)
MBS2138263-02 0.2 mL

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)

Ask
View Details
FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)
MBS2138263-03 0.5 mL

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)

Ask
View Details
FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)
MBS2138263-04 1 mL

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)

Ask
View Details
FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)
MBS2138263-05 5 mL

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)

Ask
View Details
FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)
MBS2138263-06 5x 5 mL

FITC Linked Polyclonal Antibody to Histone Gene Specific Epigenetic Repressor in Late S Phase, Isoform D (Hers)

Ask
View Details