Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCU Rabbit pAb (APR22869N)

Product Specifications

Background

This gene encodes a calcium transporter that localizes to the mitochondrial inner membrane. The encoded protein interacts with mitochondrial calcium uptake 1. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MCU Rabbit pAb (APR22869N) .

Synonyms

MCU; C10orf42; CCDC109A; HsMCU

Gene ID

90550

UniProt

Q8NE86

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/36kDa/39kDa Observed MW: 30KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=90550

Uniprot URL

https://www.uniprot.org/uniprot/Q8NE86

AA Sequence

MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 (ITGB3, Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), GP3A, GPIIIa, Integrin beta-3, Platelet membrane glycoprotein IIIa) (FITC) discontinued, see 228149
C2414-01 100 Tests

CD61 (ITGB3, Integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), GP3A, GPIIIa, Integrin beta-3, Platelet membrane glycoprotein IIIa) (FITC) discontinued, see 228149

Sign In for Pricing
View Details
ITGBL1 Protein Lysate (Mouse) with C-HA Tag
25180034 100 µg

ITGBL1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Synaptotagmin Rabbit Polyclonal Antibody
E28PT4485 100 µL

Synaptotagmin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Centrin 3 Antibody (OTI4G5) [DyLight 755]
NBP2-70409IR 0.1 mL

Mouse Monoclonal Centrin 3 Antibody (OTI4G5) [DyLight 755]

Sign In for Pricing
View Details
TBC1D16 Human shRNA Lentiviral Particle (Locus ID 125058)
TL301208V 500 µL Each

TBC1D16 Human shRNA Lentiviral Particle (Locus ID 125058)

Sign In for Pricing
View Details
Horse Proteoglycans ELISA Kit
MBS029066-01 48 Well

Horse Proteoglycans ELISA Kit

Sign In for Pricing
View Details