Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCU Rabbit pAb (APR22869N)

Product Specifications

Background

This gene encodes a calcium transporter that localizes to the mitochondrial inner membrane. The encoded protein interacts with mitochondrial calcium uptake 1. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MCU Rabbit pAb (APR22869N) .

Synonyms

MCU; C10orf42; CCDC109A; HsMCU

Gene ID

90550

UniProt

Q8NE86

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/36kDa/39kDa Observed MW: 30KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=90550

Uniprot URL

https://www.uniprot.org/uniprot/Q8NE86

AA Sequence

MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit
MBS7200748-01 48 Well

Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit
MBS7200748-02 96 Well

Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit
MBS7200748-03 5x 96 Well

Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit
MBS7200748-04 10x 96 Well

Guinea pig seminal plasma protein homolog 1 (BSPH1) ELISA Kit

Sign In for Pricing
View Details
0.05% Trypsin Solution (dissolved in D-Hank's)
PB180220 100 mL

0.05% Trypsin Solution (dissolved in D-Hank's)

Sign In for Pricing
View Details
Influenza A ns1 (NS1-23-1) Alexa Fluor® 546
sc-130568 AF546 200 µg/mL

Influenza A ns1 (NS1-23-1) Alexa Fluor® 546

Sign In for Pricing
View Details