Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSIG1 Rabbit pAb (APR22866N)

Product Specifications

Background

This gene encodes an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. The encoded protein has six transmembrane helices which contain an effector protein binding site. It binds the sterol-sensing domains of sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase), and is essential for the sterol-mediated trafficking of these two proteins. It promotes the endoplasmic reticulum retention of SCAP and the ubiquitin-mediated degradation of HMG-CoA reductase. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality INSIG1 Rabbit pAb (APR22866N) .

Synonyms

INSIG1; CL6

Gene ID

3638

UniProt

O15503

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/29kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3638

Uniprot URL

https://www.uniprot.org/uniprot/O15503

AA Sequence

LWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66, Biliary Glycoprotein, BGP-1) (BSA & Azide Free) (MaxLight 550)
172161-AF-ML550 100 µL

Carcinoembryonic Antigen (Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66, Biliary Glycoprotein, BGP-1) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
BTLA Rabbit pAb
E2513449 100 µL

BTLA Rabbit pAb

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)
MBS1123445-01 0.02 mg (E-Coli)

Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)
MBS1123445-02 0.02 mg (Yeast)

Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)
MBS1123445-03 0.1 mg (E-Coli)

Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)
MBS1123445-04 0.1 mg (Yeast)

Recombinant Salmonella enteritidis PT4 UPF0597 protein yhaM (yhaM)

Sign In for Pricing
View Details