Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRD2 Rabbit pAb (APR22835N)

Product Specifications

Background

This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BRD2 Rabbit pAb (APR22833N1) .

Synonyms

BRD2; BRD2-IT1; D6S113E; FSH; FSRG1; NAT; O27.1.1; RING3; RNF3

Gene ID

6046

UniProt

P25440

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 74kDa/83kDa/88kDa/92kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6046

Uniprot URL

https://www.uniprot.org/uniprot/P25440

AA Sequence

MASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/TR Anti-Mouse CD162 Antibody [4RA10]
MBS2569647-01 50 Tests

PE/TR Anti-Mouse CD162 Antibody [4RA10]

Sign In for Pricing
View Details
PE/TR Anti-Mouse CD162 Antibody [4RA10]
MBS2569647-02 100 Tests

PE/TR Anti-Mouse CD162 Antibody [4RA10]

Sign In for Pricing
View Details
PE/TR Anti-Mouse CD162 Antibody [4RA10]
MBS2569647-03 2x 100 Tests

PE/TR Anti-Mouse CD162 Antibody [4RA10]

Sign In for Pricing
View Details
PE/TR Anti-Mouse CD162 Antibody [4RA10]
MBS2569647-04 10x 100 Tests

PE/TR Anti-Mouse CD162 Antibody [4RA10]

Sign In for Pricing
View Details
LYAR Rabbit Polyclonal Antibody (HRP)
orb2581784 100 µg

LYAR Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Culture Medium for Human Colorectal Adenocarcinoma Lung Metastatic Cells [T84]
AFG-ELL-2716-01 125 mL

Culture Medium for Human Colorectal Adenocarcinoma Lung Metastatic Cells [T84]

Sign In for Pricing
View Details