Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] KMT5C Rabbit pAb (APR22828N)

Product Specifications

Background

SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] KMT5C Rabbit pAb (APR22828N) .

Synonyms

KMT5C; SUV420H2; Suv4-20h2

Gene ID

84787

UniProt

Q86Y97

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/52kDa Observed MW: 52KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84787

Uniprot URL

https://www.uniprot.org/uniprot/Q86Y97

AA Sequence

FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse AKT Interacting Protein (AKTIP) ELISA Kit
abx555602 96 Tests

Mouse AKT Interacting Protein (AKTIP) ELISA Kit

Sign In for Pricing
View Details
GENLISA™ Bovine Inhibin B (INHB) ELISA
KLB2357 1x 96 Well

GENLISA™ Bovine Inhibin B (INHB) ELISA

Sign In for Pricing
View Details
Bovine IgG ELISA Kit
E6012 96T

Bovine IgG ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) MAD1 Polyclonal Antibody
MBS7149954 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) MAD1 Polyclonal Antibody

Sign In for Pricing
View Details
GPR64 (ADGRG2) (NM_005756) Human Tagged ORF Clone Lentiviral Particle
RC222702L3V 200 µL

GPR64 (ADGRG2) (NM_005756) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ik Rabbit Polyclonal Antibody (FITC)
orb2110722 100 µL

Ik Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details