Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] KMT5C Rabbit pAb (APR22828N)

Product Specifications

Background

SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] KMT5C Rabbit pAb (APR22828N) .

Synonyms

KMT5C; SUV420H2; Suv4-20h2

Gene ID

84787

UniProt

Q86Y97

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/52kDa Observed MW: 52KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84787

Uniprot URL

https://www.uniprot.org/uniprot/Q86Y97

AA Sequence

FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CT A (6E19) Rabbit Monoclonal Antibody
E28M0969 100 µL

CT A (6E19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Alkyne-PEG3-iodide, 25 g
2193-25g 25 g

Alkyne-PEG3-iodide, 25 g

Sign In for Pricing
View Details
MAPKSP1 (LAMTOR3, MAP2K1IP1, MAPKSP1, Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-binding Partner 1, Mp1, Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1, Mitogen-activated Protein Kinase Scaffold Protein 1, PRO2783) (MaxLight 750) discontinued
129420-ML750 100 µL

MAPKSP1 (LAMTOR3, MAP2K1IP1, MAPKSP1, Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-binding Partner 1, Mp1, Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1, Mitogen-activated Protein Kinase Scaffold Protein 1, PRO2783) (MaxLight 750) discontinued

Sign In for Pricing
View Details
C7 sgRNA CRISPR Lentivector (Human) (Target 1)
K0252802 1.0 µg DNA

C7 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Canine Vitamin A (VA) ELISA Kit
EIA06506Ca 1 Kit

Canine Vitamin A (VA) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 10/13 Antibody (DE-K13) [Alexa Fluor 647]
NBP3-11497AF647 0.1 mL

Mouse Monoclonal Cytokeratin 10/13 Antibody (DE-K13) [Alexa Fluor 647]

Sign In for Pricing
View Details