Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID4 Rabbit pAb (APR22822N)

Product Specifications

Background

This gene encodes a member of the inhibitor of DNA binding (ID) protein family. These proteins are basic helix-loop-helix transcription factors which can act as tumor suppressors but lack DNA binding activity. Consequently, the activity of the encoded protein depends on the protein binding partner.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ID4 Rabbit pAb (APR22822N) .

Synonyms

ID4; IDB4; bHLHb27

Gene ID

3400

UniProt

P47928

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3400

Uniprot URL

https://www.uniprot.org/uniprot/P47928

AA Sequence

MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TET3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B7]
TA803982BM 100 µL

TET3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B7]

Sign In for Pricing
View Details
Variable Volume Single Channel Micropipette BPIP-506
BPIP-506 1 Unit

Variable Volume Single Channel Micropipette BPIP-506

Sign In for Pricing
View Details
Cdh10 Mouse Gene Knockout Kit (CRISPR)
KN502999 1 Kit

Cdh10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF740 conjugate, 0.1mg/mL
BNC740700-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
100mM dNTP Set, dATP, dGTP, dTTP, dCTP, 1ml/100µmol of each
PR3101-S-4 1 Each

100mM dNTP Set, dATP, dGTP, dTTP, dCTP, 1ml/100µmol of each

Sign In for Pricing
View Details
Sodium 2-Ethylhexyl Sulfate (40%-60% in Water)
TRC-S699405-50G 50 g

Sodium 2-Ethylhexyl Sulfate (40%-60% in Water)

Sign In for Pricing
View Details