Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (APR22819N)

Product Specifications

Background

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis. May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (APR22819N) .

Synonyms

CSNK1A1; CK1; CK1a; CKIa; HEL-S-77p; HLCDGP1; PRO2975

Gene ID

1452

UniProt

P48729

Cellular Locus

Chromosome, Cytoplasm, Nucleus speckle, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/38kDa/41kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1452

Uniprot URL

https://www.uniprot.org/uniprot/P48729

AA Sequence

LFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-500 1x 500 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details