Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTCD1 Rabbit pAb (APR22812N)

Product Specifications

Background

This gene encodes a mitochondrial protein that binds leucine tRNAs and other mitochondrial RNAs and plays a role in the regulation of translation. Increased expression of this gene results in decreased mitochondrial leucine tRNA levels. Naturally occurring read-through transcription exists between upstream ATP5J2 (ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2) and this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTCD1 Rabbit pAb (APR22812N) .

Synonyms

PTCD1

Gene ID

26024

UniProt

O75127

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 78kDa Observed MW: 79kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26024

Uniprot URL

https://www.uniprot.org/uniprot/O75127

AA Sequence

PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxc8, NT (Hoxc8, Hox-3.1, Hoxc-8, Homeobox protein Hox-C8, Homeobox protein Hox-3.1, Homeobox protein M31) (MaxLight 490) discontinued
036723-ML490 100 µL

Hoxc8, NT (Hoxc8, Hox-3.1, Hoxc-8, Homeobox protein Hox-C8, Homeobox protein Hox-3.1, Homeobox protein M31) (MaxLight 490) discontinued

Sign In for Pricing
View Details
PE anti-human CD227 (MUC-1)
E16FHP227-100 100 Tests

PE anti-human CD227 (MUC-1)

Sign In for Pricing
View Details
LCN2 Chemi-Luminescent ELISA Kit (Human)
OKCD03826-96W 96 Well

LCN2 Chemi-Luminescent ELISA Kit (Human)

Sign In for Pricing
View Details
C6orf221 sgRNA CRISPR Lentivector (Human) (Target 2)
K0252203 1.0 µg DNA

C6orf221 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Guinea pig Androstenedione (ASD) ELISA Kit
NSL1470Gp 96 Tests

Guinea pig Androstenedione (ASD) ELISA Kit

Sign In for Pricing
View Details
((S) -5-Oxopyrrolidine-2-Carbonyl) -L-Alanine
OR1025843-01 100 mg

((S) -5-Oxopyrrolidine-2-Carbonyl) -L-Alanine

Sign In for Pricing
View Details