Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD54B Rabbit pAb (APR22801N)

Product Specifications

Background

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAD54B Rabbit pAb (APR22801N) .

Synonyms

RAD54B; RDH54

Gene ID

25788

UniProt

Q9Y620

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 103kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25788

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y620

AA Sequence

RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-96-5p miRNA Inhibitor
MIM03269 2x 5.0 nmol

mmu-miR-96-5p miRNA Inhibitor

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Human IgA Heavy Chain Secondary Antibody [PE]
NB7441PE 1 mL

Goat Polyclonal Goat anti-Human IgA Heavy Chain Secondary Antibody [PE]

Sign In for Pricing
View Details
CRABP2 Antibody, FITC conjugated
A18081-100UG 100 µg

CRABP2 Antibody, FITC conjugated

Sign In for Pricing
View Details
JIP1 (MAPK8IP1) (NM_005456) Human Tagged Lenti ORF Clone
RC209734L2 10 µg

JIP1 (MAPK8IP1) (NM_005456) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse AMBRA1 Protein, His (Fc)-Avi-tagged
AMBRA1-501M 50 µg

Recombinant Mouse AMBRA1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
MEST (Mesoderm Specific Transcript Homolog, PEG1) (MaxLight 405)
MBS6426556-01 0.1 mL

MEST (Mesoderm Specific Transcript Homolog, PEG1) (MaxLight 405)

Sign In for Pricing
View Details