Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD54B Rabbit pAb (APR22801N)

Product Specifications

Background

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAD54B Rabbit pAb (APR22801N) .

Synonyms

RAD54B; RDH54

Gene ID

25788

UniProt

Q9Y620

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 103kDa Observed MW: 103kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25788

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y620

AA Sequence

RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim65 Mouse qPCR Primer Pair (NM_178802)
MP217601 200 Reactions

Trim65 Mouse qPCR Primer Pair (NM_178802)

Sign In for Pricing
View Details
FBXO11 Human qPCR Primer Pair (NM_025133)
HP230568 200 Reactions

FBXO11 Human qPCR Primer Pair (NM_025133)

Sign In for Pricing
View Details
Anti-ERR3 antibody
STJ192314 200 µl

Anti-ERR3 antibody

Sign In for Pricing
View Details
Phospho-PTPN7 (Ser246) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5557R-BF594 100 µL

Phospho-PTPN7 (Ser246) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
HSP90AA2P Human shRNA Plasmid Kit (Locus ID 3324)
TG312312 1 Kit

HSP90AA2P Human shRNA Plasmid Kit (Locus ID 3324)

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae hemE Protein (aa 1-354)
VAng-Cr4857-50gEcoli 50 µg (E. coli)

Recombinant Klebsiella Pneumoniae hemE Protein (aa 1-354)

Sign In for Pricing
View Details