Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR6 Rabbit pAb (APR22799N)

Product Specifications

Background

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha) . This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCR6 Rabbit pAb (APR22792N6) .

Synonyms

CCR6; BN-1; C-C CKR-6; CC-CKR-6; CCR-6; CD196; CKR-L3; CKRL3; CMKBR6; DCR2; DRY6; GPR29; GPRCY4; STRL22

Gene ID

1235

UniProt

P51684

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 52kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1235

Uniprot URL

https://www.uniprot.org/uniprot/P51684

AA Sequence

VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b) (FITC)
MBS6149667-01 0.1 mL

SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b) (FITC)

Ask
View Details
SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b) (FITC)
MBS6149667-02 5x 0.1 mL

SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b) (FITC)

Ask
View Details
Hacl1 (NM_019975) Mouse Tagged ORF Clone
MG209103 10 µg

Hacl1 (NM_019975) Mouse Tagged ORF Clone

Ask
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (FITC)
244385-FITC 100 µL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (FITC)

Ask
View Details
Lentiviral mouse Sympk shRNA (UAS) - Lentiviral mouse Sympk shRNA (UAS, RFP) (25)
GTR15287339 1 Vial

Lentiviral mouse Sympk shRNA (UAS) - Lentiviral mouse Sympk shRNA (UAS, RFP) (25)

Ask
View Details
FITC Linked Monoclonal Antibody to Mannose Associated Serine Protease 2 (MASP2)
MBS2131758-01 0.1 mL

FITC Linked Monoclonal Antibody to Mannose Associated Serine Protease 2 (MASP2)

Ask
View Details