Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR6 Rabbit pAb (APR22799N)

Product Specifications

Background

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha) . This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCR6 Rabbit pAb (APR22792N6) .

Synonyms

CCR6; BN-1; C-C CKR-6; CC-CKR-6; CCR-6; CD196; CKR-L3; CKRL3; CMKBR6; DCR2; DRY6; GPR29; GPRCY4; STRL22

Gene ID

1235

UniProt

P51684

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 52kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1235

Uniprot URL

https://www.uniprot.org/uniprot/P51684

AA Sequence

VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSL1 Protein Vector (Rat) (pPB-C-His)
PV283406 500 ng

MSL1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
EHD1 Human Over-expression Lysate
orb1347184 100 µg

EHD1 Human Over-expression Lysate

Sign In for Pricing
View Details
Monkey Ataxin 3 (ATXN3) ELISA Kit
MBS9910186-01 48 Well

Monkey Ataxin 3 (ATXN3) ELISA Kit

Sign In for Pricing
View Details
Monkey Ataxin 3 (ATXN3) ELISA Kit
MBS9910186-02 96 Well

Monkey Ataxin 3 (ATXN3) ELISA Kit

Sign In for Pricing
View Details
Monkey Ataxin 3 (ATXN3) ELISA Kit
MBS9910186-03 5x 96 Well

Monkey Ataxin 3 (ATXN3) ELISA Kit

Sign In for Pricing
View Details
Monkey Ataxin 3 (ATXN3) ELISA Kit
MBS9910186-04 10x 96 Well

Monkey Ataxin 3 (ATXN3) ELISA Kit

Sign In for Pricing
View Details