Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR141 Rabbit pAb (APR22776N)

Product Specifications

Background

GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GPR141 Rabbit pAb (APR22771N4) .

Synonyms

GPR141; PGR13

Gene ID

353345

UniProt

Q7Z602

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=353345

Uniprot URL

https://www.uniprot.org/uniprot/Q7Z602

AA Sequence

VTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit
MBS7269059-01 48 Well

Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit

Sign In for Pricing
View Details
Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit
MBS7269059-02 96 Well

Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit

Sign In for Pricing
View Details
Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit
MBS7269059-03 5x 96 Well

Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit

Sign In for Pricing
View Details
Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit
MBS7269059-04 10x 96 Well

Human DNA mismatch repair protein Msh3 (MSH3) ELISA Kit

Sign In for Pricing
View Details
Cow Interleukin 16 (IL16) CLIA Kit
abx490883-01 96 Tests

Cow Interleukin 16 (IL16) CLIA Kit

Sign In for Pricing
View Details
Cow Interleukin 16 (IL16) CLIA Kit
abx490883-02 5x 96 Tests

Cow Interleukin 16 (IL16) CLIA Kit

Sign In for Pricing
View Details