Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL Rabbit pAb (APR22771N)

Product Specifications

Background

This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRL Rabbit pAb (APR22771N) .

Synonyms

PRL; GHA1; prolactin

Gene ID

5617

UniProt

P01236

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 26KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5617

Uniprot URL

https://www.uniprot.org/uniprot/P01236

AA Sequence

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Depemokimab Biosimilar - Research Grade
ICH5476-25mg 25 mg

Depemokimab Biosimilar - Research Grade

Sign In for Pricing
View Details
PE-conjugated Anti-FCRL5 (cevostamab biosimilar without anti-CD3 portion) mAb
MBS1880561-01 100 Tests

PE-conjugated Anti-FCRL5 (cevostamab biosimilar without anti-CD3 portion) mAb

Sign In for Pricing
View Details
PE-conjugated Anti-FCRL5 (cevostamab biosimilar without anti-CD3 portion) mAb
MBS1880561-02 5x 100 Tests

PE-conjugated Anti-FCRL5 (cevostamab biosimilar without anti-CD3 portion) mAb

Sign In for Pricing
View Details
RPS12 Human Over-expression Lysate
orb1342649 100 µg

RPS12 Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Gremlin 2 Antibody
YLD3637-01 50 µL

Rabbit anti-Gremlin 2 Antibody

Sign In for Pricing
View Details
Rabbit anti-Gremlin 2 Antibody
YLD3637-02 100 µL

Rabbit anti-Gremlin 2 Antibody

Sign In for Pricing
View Details