Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL Rabbit pAb (APR22771N)

Product Specifications

Background

This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRL Rabbit pAb (APR22771N) .

Synonyms

PRL; GHA1; prolactin

Gene ID

5617

UniProt

P01236

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 26KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5617

Uniprot URL

https://www.uniprot.org/uniprot/P01236

AA Sequence

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-TMEM204 antibody
SL9436R-01 50 µL

Rabbit Anti-TMEM204 antibody

Sign In for Pricing
View Details
Rabbit Anti-TMEM204 antibody
SL9436R-02 100 µL

Rabbit Anti-TMEM204 antibody

Sign In for Pricing
View Details
DNASE1L2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0618005 3x 1.0 µg

DNASE1L2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Hepatitis B virus pre-X protein Polyclonal Antibody, PE Conjugated
bs-2147R-PE 100 µL

Hepatitis B virus pre-X protein Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
YadK Antibody
orb831638 2 mg

YadK Antibody

Sign In for Pricing
View Details
Lig3 3'UTR GFP Stable Cell Line
TU257071 1.0 mL

Lig3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details