Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGOL1 Rabbit pAb (APR22765N)

Product Specifications

Background

The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714) . Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101) . Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SGOL1 Rabbit pAb (APR22760N4) .

Synonyms

SGO1; CAID; NY-BR-85; SGO; SGOL1

Gene ID

151648

UniProt

Q5FBB7

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center, spindle pole

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/29kDa/31kDa/33kDa/35kDa/60kDa/64kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=151648

Uniprot URL

https://www.uniprot.org/uniprot/Q5FBB7

AA Sequence

SFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2,6-Dimethyltetrahydro-2H-pyran-4-yl) ethan-1-amine hydrochloride
OR1046824-01 100 mg

2- (2,6-Dimethyltetrahydro-2H-pyran-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (2,6-Dimethyltetrahydro-2H-pyran-4-yl) ethan-1-amine hydrochloride
OR1046824-02 250 mg

2- (2,6-Dimethyltetrahydro-2H-pyran-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (2,6-Dimethyltetrahydro-2H-pyran-4-yl) ethan-1-amine hydrochloride
OR1046824-03 1 g

2- (2,6-Dimethyltetrahydro-2H-pyran-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
Rabbit Polyclonal Otubain-1 Antibody
NBP1-49934 0.1 mL

Rabbit Polyclonal Otubain-1 Antibody

Sign In for Pricing
View Details
DAPK1 Knockout Cell Lysate
ABC-KC0488 100 µg

DAPK1 Knockout Cell Lysate

Sign In for Pricing
View Details
Anti-CAMKK2 Antibody Picoband®, HRP Conjugate
PA1497-HRP 100 µg

Anti-CAMKK2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details