Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF185 Rabbit pAb (APR22747N)

Product Specifications

Background

E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1. Acts in the endoplasmic reticulum (ER-associated degradation (ERAD pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-induced apoptosis. Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway. Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF185 Rabbit pAb (APR22738N8) .

Synonyms

RNF185

Gene ID

91445

UniProt

Q96GF1

Cellular Locus

Endoplasmic reticulum membrane, Mitochondrion outer membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/20kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=91445

Uniprot URL

https://www.uniprot.org/uniprot/Q96GF1

AA Sequence

MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloro-N'-hydroxy-2-methylbenzenecarboximidamide
OR1079656 1 Each

4-Chloro-N'-hydroxy-2-methylbenzenecarboximidamide

Sign In for Pricing
View Details
Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit
MBS9319689-01 48 Well

Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit

Sign In for Pricing
View Details
Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit
MBS9319689-02 96 Well

Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit

Sign In for Pricing
View Details
Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit
MBS9319689-03 5x 96 Well

Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit

Sign In for Pricing
View Details
Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit
MBS9319689-04 10x 96 Well

Rat Rab GDP dissociation inhibitor alpha, GDI1 ELISA Kit

Sign In for Pricing
View Details
Gspt1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6831404 1.0 µg DNA

Gspt1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details