Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF185 Rabbit pAb (APR22747N)

Product Specifications

Background

E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1. Acts in the endoplasmic reticulum (ER-associated degradation (ERAD pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-induced apoptosis. Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway. Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF185 Rabbit pAb (APR22738N8) .

Synonyms

RNF185

Gene ID

91445

UniProt

Q96GF1

Cellular Locus

Endoplasmic reticulum membrane, Mitochondrion outer membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/20kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=91445

Uniprot URL

https://www.uniprot.org/uniprot/Q96GF1

AA Sequence

MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP2, human recombinant
7804-100 100 µg

FBP2, human recombinant

Sign In for Pricing
View Details
Mouse Sh3gl1 Pre-designed siRNA Set A
SI112857A 1 Each

Mouse Sh3gl1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TET2 Knockout K-562 Cell Line
ARG44151 1 Million

TET2 Knockout K-562 Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal SH2D2A Antibody
NBP3-17766-25ul 25 µL

Rabbit Polyclonal SH2D2A Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HIC2 Antibody
NBP1-81710 0.1 mL

Rabbit Polyclonal HIC2 Antibody

Sign In for Pricing
View Details
Cyp2c23 3'UTR GFP Stable Cell Line
TU253064 1.0 mL

Cyp2c23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details