Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVRL4 Rabbit pAb (APR22737N)

Product Specifications

Background

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PVRL4 Rabbit pAb (APR22727N9) .

Synonyms

NECTIN4; EDSS1; LNIR; PRR4; PVRL4; nectin-4

Gene ID

81607

UniProt

Q96NY8

Cellular Locus

Cell junction, Cell membrane, Secreted, Single-pass type I membrane protein, adherens junction

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/55kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81607

Uniprot URL

https://www.uniprot.org/uniprot/Q96NY8

AA Sequence

MSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PSG6, NT (PSG6, CGM3, PSG10, PSG12, PSGGB, Pregnancy-specific beta-1-glycoprotein 6, Pregnancy-specific beta-1-glycoprotein 10, Pregnancy-specific beta-1-glycoprotein 12) (APC)
MBS6338085-01 0.2 mL

PSG6, NT (PSG6, CGM3, PSG10, PSG12, PSGGB, Pregnancy-specific beta-1-glycoprotein 6, Pregnancy-specific beta-1-glycoprotein 10, Pregnancy-specific beta-1-glycoprotein 12) (APC)

Ask
View Details
PSG6, NT (PSG6, CGM3, PSG10, PSG12, PSGGB, Pregnancy-specific beta-1-glycoprotein 6, Pregnancy-specific beta-1-glycoprotein 10, Pregnancy-specific beta-1-glycoprotein 12) (APC)
MBS6338085-02 5x 0.2 mL

PSG6, NT (PSG6, CGM3, PSG10, PSG12, PSGGB, Pregnancy-specific beta-1-glycoprotein 6, Pregnancy-specific beta-1-glycoprotein 10, Pregnancy-specific beta-1-glycoprotein 12) (APC)

Ask
View Details
Ruxolitinib Phosphate
27059-1 25 mg

Ruxolitinib Phosphate

Ask
View Details
HRP-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
MBS2168304-01 0.1 mL

HRP-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Ask
View Details
HRP-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
MBS2168304-02 0.2 mL

HRP-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Ask
View Details
HRP-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
MBS2168304-03 0.5 mL

HRP-Linked Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Ask
View Details