Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEM1A Rabbit pAb (APR22715N)

Product Specifications

Background

Substrate-recognition component of a Cul2-RING (CRL2 E3 ubiquitin-protein ligase complex of the DesCEND (destruction via C-end degrons pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation. The C-degron recognized by the DesCEND pathway is usually a motif of less than ten residues and can be present in full-length proteins, truncated proteins or proteolytically cleaved forms. The CRL2 (FEM1A complex specifically recognizes proteins with an arginine at the C-terminus: recognizes and binds proteins ending with -Lys/Arg-Xaa-Arg and -Lys/Arg-Xaa-Xaa-Arg C-degrons, such as SIL1 or OR51B2, leading to their ubiquitination and degradation. Promotes ubiquitination and degradation of SLBP. Involved in PGE2-EP4-mediated inhibition of inflammation of macrophages via interaction with NFKB1 and PTGER4 (By similarity. Promotes inflammation in brain microglia through MAP2K4/MKK4-mediated signaling (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FEM1A Rabbit pAb (APR22715N) .

Synonyms

FEM1A; EPRAP

Gene ID

55527

UniProt

Q9BSK4

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 73kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55527

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSK4

AA Sequence

RSLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPGQEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid-PEG14-t-butyl ester
MF-0064434-01 10 mg

Acid-PEG14-t-butyl ester

Sign In for Pricing
View Details
Acid-PEG14-t-butyl ester
MF-0064434-02 50 mg

Acid-PEG14-t-butyl ester

Sign In for Pricing
View Details
Tumor Necrosis Factor (TNF) Antibody (HRP)
abx109231-01 20 µg

Tumor Necrosis Factor (TNF) Antibody (HRP)

Sign In for Pricing
View Details
Tumor Necrosis Factor (TNF) Antibody (HRP)
abx109231-02 50 µg

Tumor Necrosis Factor (TNF) Antibody (HRP)

Sign In for Pricing
View Details
Tumor Necrosis Factor (TNF) Antibody (HRP)
abx109231-03 100 µg

Tumor Necrosis Factor (TNF) Antibody (HRP)

Sign In for Pricing
View Details
Tumor Necrosis Factor (TNF) Antibody (HRP)
abx109231-04 200 µg

Tumor Necrosis Factor (TNF) Antibody (HRP)

Sign In for Pricing
View Details