Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPN2 Rabbit pAb (APR22692N)

Product Specifications

Background

This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EPN2 Rabbit pAb (APR22692N) .

Synonyms

EPN2; EHB21; epsin-2

Gene ID

22905

UniProt

O95208

Cellular Locus

Cytoplasm, Cytoplasmic vesicle, clathrin-coated vesicle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/57kDa/62kDa/68kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22905

Uniprot URL

https://www.uniprot.org/uniprot/O95208

AA Sequence

GINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4bp2l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3542105 3x 1.0 µg

N4bp2l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ACOX2 Rabbit pAb
E45R19407N-100 100 µL

ACOX2 Rabbit pAb

Sign In for Pricing
View Details
PCK2 Antibody
OAAN03817-100UL 100 µL

PCK2 Antibody

Sign In for Pricing
View Details
TRNAW9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48473061 1.0 µg DNA

TRNAW9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rno-miR-381-5p miRNA Agomir
CMS0496-01 5 nmol

Rno-miR-381-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-381-5p miRNA Agomir
CMS0496-02 10 nmol

Rno-miR-381-5p miRNA Agomir

Sign In for Pricing
View Details