Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS21 Rabbit pAb (APR22686N)

Product Specifications

Background

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. The encoded protein is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The encoded protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and may be involved in progression of testicular tumors of germ cell origin. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRSS21 Rabbit pAb (APR22686N) .

Synonyms

PRSS21; ESP-1; ESP1; TEST1; TESTISIN; testisin

Gene ID

10942

UniProt

Q9Y6M0

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa/34kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10942

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y6M0

AA Sequence

TKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc Antibody (Phospho-Thr358) : Biotin (OAAF07748-Biotin)
OAAF07748-100UG-Biotin 100 µg

Myc Antibody (Phospho-Thr358) : Biotin (OAAF07748-Biotin)

Sign In for Pricing
View Details
Anti-Blood Group Antigen Lewis B Monoclonal Antibody (Clone: SPM194)
36-2353-100 100 µg

Anti-Blood Group Antigen Lewis B Monoclonal Antibody (Clone: SPM194)

Sign In for Pricing
View Details
Mouse Second mitochondria-derived activator of caspase (SMAC; DIABLO) ELISA Kit
YP-W24570-01 48 Tests

Mouse Second mitochondria-derived activator of caspase (SMAC; DIABLO) ELISA Kit

Sign In for Pricing
View Details
Mouse Second mitochondria-derived activator of caspase (SMAC; DIABLO) ELISA Kit
YP-W24570-02 96 Tests

Mouse Second mitochondria-derived activator of caspase (SMAC; DIABLO) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PRR5L Antibody [DyLight 350]
NBP1-76568UV 0.1 mL

Rabbit Polyclonal PRR5L Antibody [DyLight 350]

Sign In for Pricing
View Details
DYNLRB2
pro-174 5µg

DYNLRB2

Sign In for Pricing
View Details